SCOPe 2.05: Domain d2qxyb_: 2qxy B:

Lineage for d2qxyb_ (2qxy B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (59 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [188956] (11 PDB entries)

8. Domain d2qxyb_: 2qxy B: [205897]
   automated match to d1xhfb_
   complexed with so4

Details for d2qxyb_

PDB Entry: 2qxy, 1.95 Å

PDB Description: crystal structure of a response regulator from thermotoga maritima

PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d2qxyb_:

Sequence; same for both SEQRES and ATOM records:

>d2qxyb_ c.23.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
tptvmvvdesritflavknalekdgfnviwakneqeaftflrrekidlvfvdvfegeesl
nlirrireefpdtkvavlsayvdkdliinsvkagavdyilkpfrldyllervkkiis

Timeline for d2qxyb_:

• d2qxyb_ first appeared in SCOPe 2.03
  
• d2qxyb_ appears in SCOPe 2.04
  
• d2qxyb_ appears in SCOPe 2.06
  
• d2qxyb_ appears in the current release, SCOPe 2.08