Lineage for d2qvga_ (2qvg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856008Species Legionella pneumophila [TaxId:272624] [225321] (1 PDB entry)
  8. 2856009Domain d2qvga_: 2qvg A: [205894]
    automated match to d3heba_

Details for d2qvga_

PDB Entry: 2qvg (more details), 1.5 Å

PDB Description: the crystal structure of a two-component response regulator from legionella pneumophila
PDB Compounds: (A:) Two component response regulator

SCOPe Domain Sequences for d2qvga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qvga_ c.23.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
kvdilyleddevdiqsvervfhkisslikieiaksgnqaldmlygrnkenkihpklilld
inipkmngieflkelrddssftdievfvltaaytskdklafeslnirghlikpldygeai
klfwilqsm

SCOPe Domain Coordinates for d2qvga_:

Click to download the PDB-style file with coordinates for d2qvga_.
(The format of our PDB-style files is described here.)

Timeline for d2qvga_: