SCOPe 2.08: Domain d2qvfb2: 2qvf B:102-213

Lineage for d2qvfb2 (2qvf B:102-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries)

8. Domain d2qvfb2: 2qvf B:102-213 [205893]
   automated match to d1ncja2
   complexed with ca

Details for d2qvfb2

PDB Entry: 2qvf, 2.4 Å

PDB Description: mouse E-cadherin domains 1,2

PDB Compounds: (B:) Epithelial-cadherin (E-cadherin) (Uvomorulin) (Cadherin-1) (ARC-1) (CD324 antigen)

SCOPe Domain Sequences for d2qvfb2:

Sequence; same for both SEQRES and ATOM records:

>d2qvfb2 b.1.6.0 (B:102-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkd

Timeline for d2qvfb2:

• d2qvfb2 first appeared in SCOPe 2.03
  
• d2qvfb2 appears in SCOPe 2.07