SCOPe 2.08: Domain d2qv0a_: 2qv0 A:

Lineage for d2qv0a_ (2qv0 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225322] (2 PDB entries)

8. Domain d2qv0a_: 2qv0 A: [205890]
   automated match to d3hdga_

Details for d2qv0a_

PDB Entry: 2qv0, 2.4 Å

PDB Description: crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae

PDB Compounds: (A:) Protein mrkE

SCOPe Domain Sequences for d2qv0a_:

Sequence; same for both SEQRES and ATOM records:

>d2qv0a_ c.23.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mkviivedeflaqqelswlinthsqmeivgsfddgldvlkflqhnkvdaifldinipsld
gvllaqnisqfahkpfivfitawkehaveafeleafdyilkpyqesriinmlqklttawe
qq

Timeline for d2qv0a_:

• d2qv0a_ first appeared in SCOPe 2.03
  
• d2qv0a_ appears in SCOPe 2.07