Lineage for d2qv0a_ (2qv0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855996Species Klebsiella pneumoniae [TaxId:573] [225322] (2 PDB entries)
  8. 2855997Domain d2qv0a_: 2qv0 A: [205890]
    automated match to d3hdga_

Details for d2qv0a_

PDB Entry: 2qv0 (more details), 2.4 Å

PDB Description: crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae
PDB Compounds: (A:) Protein mrkE

SCOPe Domain Sequences for d2qv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qv0a_ c.23.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mkviivedeflaqqelswlinthsqmeivgsfddgldvlkflqhnkvdaifldinipsld
gvllaqnisqfahkpfivfitawkehaveafeleafdyilkpyqesriinmlqklttawe
qq

SCOPe Domain Coordinates for d2qv0a_:

Click to download the PDB-style file with coordinates for d2qv0a_.
(The format of our PDB-style files is described here.)

Timeline for d2qv0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qv0b_