Lineage for d2qupa_ (2qup A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988404Superfamily a.24.29: TM1646-like [158397] (2 families) (S)
    automatically mapped to Pfam PF03885
  5. 1988409Family a.24.29.0: automated matches [227214] (1 protein)
    not a true family
  6. 1988410Protein automated matches [226951] (1 species)
    not a true protein
  7. 1988411Species Bacillus halodurans [TaxId:86665] [225320] (1 PDB entry)
  8. 1988412Domain d2qupa_: 2qup A: [205889]
    automated match to d2p61a1
    complexed with gol

Details for d2qupa_

PDB Entry: 2qup (more details), 2 Å

PDB Description: crystal structure of uncharacterized protein bh1478 from bacillus halodurans
PDB Compounds: (A:) BH1478 protein

SCOPe Domain Sequences for d2qupa_:

Sequence, based on SEQRES records: (download)

>d2qupa_ a.24.29.0 (A:) automated matches {Bacillus halodurans [TaxId: 86665]}
gvsfsevmgkqrdekayerlqalmskiddqgkllsetrtieelrkykelvkefvgdavel
glrleerrgfnrrgrtkiykivkevdrklldltdavlakekkgldilnmvgeikgllini
ya

Sequence, based on observed residues (ATOM records): (download)

>d2qupa_ a.24.29.0 (A:) automated matches {Bacillus halodurans [TaxId: 86665]}
gvsfsevmgkqrdekayerlqalmskiddqgkllsetrtieelrkykelvkefvgdavel
glrleernrrgrtkiykivkevdrklldltdavlakekkgldilnmvgeikglliniya

SCOPe Domain Coordinates for d2qupa_:

Click to download the PDB-style file with coordinates for d2qupa_.
(The format of our PDB-style files is described here.)

Timeline for d2qupa_: