SCOPe 2.03: Domain d2qu7a_: 2qu7 A:

Lineage for d2qu7a_ (2qu7 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (31 species)
   not a true protein

7. Species Staphylococcus saprophyticus [TaxId:342451] [225319] (1 PDB entry)

8. Domain d2qu7a_: 2qu7 A: [205887]
   automated match to d4kmra_
   complexed with cl

Details for d2qu7a_

PDB Entry: 2qu7, 2.3 Å

PDB Description: crystal structure of a putative transcription regulator from staphylococcus saprophyticus subsp. saprophyticus

PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d2qu7a_:

Sequence; same for both SEQRES and ATOM records:

>d2qu7a_ c.93.1.0 (A:) automated matches {Staphylococcus saprophyticus [TaxId: 342451]}
rsniiafivpdqnpfftevlteishecqkhhlhvavasseenedkqqdlietfvsqnvsa
iilvpvkskfqmkrewlkipimtldrelestslpsitvdneeaayiatkrvlestckevg
lllanpnisttigrkngynkaisefdlnvnpslihysdqqlgtnaqiysgyeatktllsk
gikgivatnhllllgalqaikesekeikkdviivgfddsywneiytpkltvisqpvkemg
qvaakmiyklikgkdvtsiklstkliirescsfn

Timeline for d2qu7a_:

• d2qu7a_ is new in SCOPe 2.03-stable
  
• d2qu7a_ appears in SCOPe 2.04
  
• d2qu7a_ appears in the current release, SCOPe 2.08