SCOPe 2.08: Domain d2qr3a1: 2qr3 A:2-125

Lineage for d2qr3a1 (2qr3 A:2-125)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Bacteroides fragilis [TaxId:295405] [225318] (1 PDB entry)

8. Domain d2qr3a1: 2qr3 A:2-125 [205876]
   Other proteins in same PDB: d2qr3a2
   automated match to d3t6ka_

Details for d2qr3a1

PDB Entry: 2qr3, 1.8 Å

PDB Description: crystal structure of the n-terminal signal receiver domain of two- component system response regulator from bacteroides fragilis

PDB Compounds: (A:) Two-component system response regulator

SCOPe Domain Sequences for d2qr3a1:

Sequence, based on SEQRES records:

>d2qr3a1 c.23.1.0 (A:2-125) automated matches {Bacteroides fragilis [TaxId: 295405]}
gtiiivddnkgvltavqlllknhfskvitlsspvslstvlreenpevvlldmnftsginn
gneglfwlheikrqyrdlpvvlftayadidlavrgikegasdfvvkpwdnqklletllna
asqa

Sequence, based on observed residues (ATOM records):

>d2qr3a1 c.23.1.0 (A:2-125) automated matches {Bacteroides fragilis [TaxId: 295405]}
gtiiivddnkgvltavqlllknhfskvitlsspvslstvlreenpevvlldmnftsnegl
fwlheikrqyrdlpvvlftayadidlavrgikegasdfvvkpwdnqklletllnaasqa

Timeline for d2qr3a1:

• d2qr3a1 first appeared in SCOPe 2.03, called d2qr3a_
  
• d2qr3a1 appears in SCOPe 2.07