Lineage for d2qqkl2 (2qqk L:108-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 2353537Domain d2qqkl2: 2qqk L:108-211 [205871]
    Other proteins in same PDB: d2qqkl1
    automated match to d1rhha2
    complexed with nag

Details for d2qqkl2

PDB Entry: 2qqk (more details), 2.75 Å

PDB Description: neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
PDB Compounds: (L:) Antibody Light Chain

SCOPe Domain Sequences for d2qqkl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qqkl2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d2qqkl2:

Click to download the PDB-style file with coordinates for d2qqkl2.
(The format of our PDB-style files is described here.)

Timeline for d2qqkl2: