SCOPe 2.06: Domain d2qqkl1: 2qqk L:1-107

Lineage for d2qqkl1 (2qqk L:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d2qqkl1: 2qqk L:1-107 [205870]
   Other proteins in same PDB: d2qqkl2
   automated match to d1rhha1
   complexed with nag

Details for d2qqkl1

PDB Entry: 2qqk, 2.75 Å

PDB Description: neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab

PDB Compounds: (L:) Antibody Light Chain

SCOPe Domain Sequences for d2qqkl1:

Sequence; same for both SEQRES and ATOM records:

>d2qqkl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqawaylptfgqgtkveik

Timeline for d2qqkl1:

• d2qqkl1 first appeared in SCOPe 2.03
  
• d2qqkl1 appears in SCOPe 2.05
  
• d2qqkl1 appears in SCOPe 2.07
  
• d2qqkl1 appears in the current release, SCOPe 2.08