Lineage for d2qq3c_ (2qq3 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853725Species Geobacillus kaustophilus [TaxId:1462] [187671] (2 PDB entries)
  8. 2853728Domain d2qq3c_: 2qq3 C: [205858]
    automated match to d3moya_
    complexed with edo

Details for d2qq3c_

PDB Entry: 2qq3 (more details), 1.95 Å

PDB Description: Crystal Structure Of Enoyl-CoA Hydrates Subunit I (gk_2039) Other Form From Geobacillus Kaustophilus HTA426
PDB Compounds: (C:) Enoyl-CoA hydratase subunit I

SCOPe Domain Sequences for d2qq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qq3c_ c.14.1.0 (C:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
sefvsiaarqegavgiielarpdvlnalsrqmvaeivaaveafdrnekvrvivltgrgra
faagadiqemakddpirlewlnqfadwdrlsivktpmiaavnglalgggfelalscdliv
assaaefgfpevnlgvmpgaggtqrltkligpkralewlwtgarmsakeaeqlgivnrvv
spellmeetmrlagrlaeqpplalrlikeavqkavdyplyegmqferknfyllfasedqk
egmaaflekrkprfqgk

SCOPe Domain Coordinates for d2qq3c_:

Click to download the PDB-style file with coordinates for d2qq3c_.
(The format of our PDB-style files is described here.)

Timeline for d2qq3c_: