SCOPe 2.06: Domain d2qppb_: 2qpp B:

Lineage for d2qppb_ (2qpp B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries)

8. Domain d2qppb_: 2qpp B: [205855]
   automated match to d1wova1
   complexed with hem

Details for d2qppb_

PDB Entry: 2qpp, 2.61 Å

PDB Description: crystal structure of human heme oxygenase-2 c127a (ho-2) with bound heme

PDB Compounds: (B:) Heme oxygenase 2

SCOPe Domain Sequences for d2qppb_:

Sequence; same for both SEQRES and ATOM records:

>d2qppb_ a.132.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
madlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernk
dhpafaplyfpmelhrkealtkdmeyffgenweeqvqapkaaqkyverihyigqnepell
vahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnal
dlnmktkeriveeankafeynmqifneldqagstlaret

Timeline for d2qppb_:

• d2qppb_ first appeared in SCOPe 2.03
  
• d2qppb_ appears in SCOPe 2.05
  
• d2qppb_ appears in SCOPe 2.07
  
• d2qppb_ appears in the current release, SCOPe 2.08