![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
![]() | Protein automated matches [191143] (13 species) not a true protein |
![]() | Species Maize (Zea mays) [TaxId:4577] [225479] (20 PDB entries) |
![]() | Domain d2qpma1: 2qpm A:33-245 [205852] Other proteins in same PDB: d2qpma2 automated match to d1w1oa2 complexed with 246, fad, nag; mutant |
PDB Entry: 2qpm (more details), 1.85 Å
SCOPe Domain Sequences for d2qpma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpma1 d.145.1.0 (A:33-245) automated matches {Maize (Zea mays) [TaxId: 4577]} pwpaslaalaldgklrtdsnataaastdfgnitsalpaavlypsstadlvallsaanstp gwpytiafrgrghslmgqafapggvvvnmaslgdaaapprinvsadgryvdaggeqvwid vlraslargvaprswtdylyltvggtlsnagisgqafrhgpqisnvlemdvitghgemvt cskqlnadlfdavlgglgqfgvitrariavepa
Timeline for d2qpma1: