Lineage for d2qojz1 (2qoj Z:3-125)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966038Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2966049Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 2966050Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 2966051Protein DNA endonuclease I-AniI [103141] (1 species)
    duplication: contains tandem repeat of this fold
  7. 2966052Species Emericella nidulans (Aspergillus nidulans) [TaxId:162425] [103142] (2 PDB entries)
    synonym: Emericella nidulans
  8. 2966055Domain d2qojz1: 2qoj Z:3-125 [205850]
    Other proteins in same PDB: d2qojz3
    automated match to d1p8kz1
    protein/DNA complex; protein/RNA complex; complexed with mg

Details for d2qojz1

PDB Entry: 2qoj (more details), 2.4 Å

PDB Description: coevolution of a homing endonuclease and its host target sequence
PDB Compounds: (Z:) Intron-encoded DNA endonuclease I-AniI

SCOPe Domain Sequences for d2qojz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qojz1 d.95.2.1 (Z:3-125) DNA endonuclease I-AniI {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]}
dltyaylvglfegdgyfsitkkgkyltyelgielsikdvqliykikkilgigivsfrkrn
eiemvalrirdknhlksfilpifekypmfsnkqydylrfrnallsgiisledlpdytrsd
epl

SCOPe Domain Coordinates for d2qojz1:

Click to download the PDB-style file with coordinates for d2qojz1.
(The format of our PDB-style files is described here.)

Timeline for d2qojz1: