![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (14 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:1491] [193827] (5 PDB entries) |
![]() | Domain d2qn0a_: 2qn0 A: [205849] automated match to d2fpqa_ complexed with zn |
PDB Entry: 2qn0 (more details), 1.75 Å
SCOPe Domain Sequences for d2qn0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qn0a_ d.92.1.0 (A:) automated matches {Clostridium botulinum [TaxId: 1491]} pitinnfnysdpvdnknilyldthlntlanepekafritgniwvipdrfsrnsnpnlnkp prvtspksgyydpnylstdsdkdtflkeiiklfkrinsreigeeliyrlstdipfpgnnn tpintfdfdvdfnsvdvktrqgnnwvktgsinpsviitgpreniidpetstfkltnntfa aqegfgalsiisisprfmltysnatndvgegrfsksefcmdpililmhelnhamhnlygi aipndqtissvtsnifysqynvkleyaeiyafggptidlipksarkyfeekaldyyrsia krlnsittanpssfnkyigeykqklirkyrfvvessgevtvnrnkfvelyneltqiftef nyakiynvqnrkiylsnvytpvtanilddnvydiqngfnipksnlnvlfmgqnlsrnpal rkvnpeplv
Timeline for d2qn0a_: