| Class b: All beta proteins [48724] (178 folds) |
| Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily) sandwich; 6 strands in 2 sheets |
Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) ![]() |
| Family b.4.1.0: automated matches [227209] (1 protein) not a true family |
| Protein automated matches [226943] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225489] (2 PDB entries) |
| Domain d2qlda2: 2qld A:246-335 [205840] automated match to d1c3ga2 |
PDB Entry: 2qld (more details), 2.7 Å
SCOPe Domain Sequences for d2qlda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qlda2 b.4.1.0 (A:246-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkrdgsdviyparislrealcgctvnvptldgrtipvvfkdvirpgmrrkvpgeglplp
ktpekrgdliiefevifperipqtsrtvle
Timeline for d2qlda2: