SCOPe 2.08: Domain d2qlda2: 2qld A:246-335

Lineage for d2qlda2 (2qld A:246-335)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families)

5. Family b.4.1.0: automated matches [227209] (1 protein)
   not a true family

6. Protein automated matches [226943] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225489] (2 PDB entries)

8. Domain d2qlda2: 2qld A:246-335 [205840]
   automated match to d1c3ga2

Details for d2qlda2

PDB Entry: 2qld, 2.7 Å

PDB Description: human Hsp40 Hdj1

PDB Compounds: (A:) DnaJ homolog subfamily B member 1

SCOPe Domain Sequences for d2qlda2:

Sequence; same for both SEQRES and ATOM records:

>d2qlda2 b.4.1.0 (A:246-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkrdgsdviyparislrealcgctvnvptldgrtipvvfkdvirpgmrrkvpgeglplp
ktpekrgdliiefevifperipqtsrtvle

Timeline for d2qlda2:

• d2qlda2 first appeared in SCOPe 2.03
  
• d2qlda2 appears in SCOPe 2.07