Lineage for d2qlda1 (2qld A:162-245)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380152Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2380153Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) (S)
  5. 2380167Family b.4.1.0: automated matches [227209] (1 protein)
    not a true family
  6. 2380168Protein automated matches [226943] (2 species)
    not a true protein
  7. 2380174Species Human (Homo sapiens) [TaxId:9606] [225489] (2 PDB entries)
  8. 2380179Domain d2qlda1: 2qld A:162-245 [205839]
    automated match to d1c3ga1

Details for d2qlda1

PDB Entry: 2qld (more details), 2.7 Å

PDB Description: human Hsp40 Hdj1
PDB Compounds: (A:) DnaJ homolog subfamily B member 1

SCOPe Domain Sequences for d2qlda1:

Sequence, based on SEQRES records: (download)

>d2qlda1 b.4.1.0 (A:162-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppvthdlrvsleeiysgctkkmkishkrlnpdgksirnedkiltievkkgwkegtkitfp
kegdqtsnnipadivfvlkdkphn

Sequence, based on observed residues (ATOM records): (download)

>d2qlda1 b.4.1.0 (A:162-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppvthdlrvsleeiysgctkkmkishkrlnpdgksirnedkiltievkkgwkegtkitfp
kegdqtipadivfvlkdkphn

SCOPe Domain Coordinates for d2qlda1:

Click to download the PDB-style file with coordinates for d2qlda1.
(The format of our PDB-style files is described here.)

Timeline for d2qlda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qlda2