SCOPe 2.07: Domain d2qlda1: 2qld A:162-245

Lineage for d2qlda1 (2qld A:162-245)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families)

5. Family b.4.1.0: automated matches [227209] (1 protein)
   not a true family

6. Protein automated matches [226943] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225489] (2 PDB entries)

8. Domain d2qlda1: 2qld A:162-245 [205839]
   automated match to d1c3ga1

Details for d2qlda1

PDB Entry: 2qld, 2.7 Å

PDB Description: human Hsp40 Hdj1

PDB Compounds: (A:) DnaJ homolog subfamily B member 1

SCOPe Domain Sequences for d2qlda1:

Sequence, based on SEQRES records:

>d2qlda1 b.4.1.0 (A:162-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppvthdlrvsleeiysgctkkmkishkrlnpdgksirnedkiltievkkgwkegtkitfp
kegdqtsnnipadivfvlkdkphn

Sequence, based on observed residues (ATOM records):

>d2qlda1 b.4.1.0 (A:162-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppvthdlrvsleeiysgctkkmkishkrlnpdgksirnedkiltievkkgwkegtkitfp
kegdqtipadivfvlkdkphn

Timeline for d2qlda1:

• d2qlda1 first appeared in SCOPe 2.03
  
• d2qlda1 appears in SCOPe 2.06
  
• d2qlda1 appears in the current release, SCOPe 2.08