Lineage for d2qkxa1 (2qkx A:2-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899371Species Mycobacterium tuberculosis [225488] (1 PDB entry)
  8. 2899372Domain d2qkxa1: 2qkx A:2-263 [205837]
    Other proteins in same PDB: d2qkxa2
    automated match to d1hm9a2
    complexed with gn1

Details for d2qkxa1

PDB Entry: 2qkx (more details), 2.75 Å

PDB Description: n-acetyl glucosamine 1-phosphate uridyltransferase from mycobacterium tuberculosis complex with n-acetyl glucosamine 1-phosphate
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d2qkxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkxa1 c.68.1.0 (A:2-263) automated matches {Mycobacterium tuberculosis}
tfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhq
riaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldad
tladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevn
agvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnr
vqlaelaselnrrvvaahqlag

SCOPe Domain Coordinates for d2qkxa1:

Click to download the PDB-style file with coordinates for d2qkxa1.
(The format of our PDB-style files is described here.)

Timeline for d2qkxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qkxa2