| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
| Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
| Protein automated matches [190951] (34 species) not a true protein |
| Species Mycobacterium tuberculosis [225488] (1 PDB entry) |
| Domain d2qkxa1: 2qkx A:2-263 [205837] Other proteins in same PDB: d2qkxa2 automated match to d1hm9a2 complexed with gn1 |
PDB Entry: 2qkx (more details), 2.75 Å
SCOPe Domain Sequences for d2qkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qkxa1 c.68.1.0 (A:2-263) automated matches {Mycobacterium tuberculosis}
tfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhq
riaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldad
tladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevn
agvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnr
vqlaelaselnrrvvaahqlag
Timeline for d2qkxa1: