Lineage for d2qkba1 (2qkb A:136-284)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2140276Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2140277Protein automated matches [190396] (35 species)
    not a true protein
  7. 2140361Species Human (Homo sapiens) [TaxId:9606] [225370] (6 PDB entries)
  8. 2140365Domain d2qkba1: 2qkb A:136-284 [205833]
    Other proteins in same PDB: d2qkba2, d2qkbb2
    automated match to d2zqba_
    protein/DNA complex; protein/RNA complex; complexed with edo, so4; mutant

Details for d2qkba1

PDB Entry: 2qkb (more details), 2.4 Å

PDB Description: human rnase h catalytic domain mutant d210n in complex with 20-mer rna/dna hybrid
PDB Compounds: (A:) Ribonuclease H1

SCOPe Domain Sequences for d2qkba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkba1 c.55.3.0 (A:136-284) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgdfvvvytdgccssngrrrpragigvywgpghplnvgirlpgrqtnqraeihaackaie
qaktqninklvlytnsmftingitnwvqgwkkngwktsagkevinkedfvalerltqgmd
iqwmhvpghsgfigneeadrlaregakqs

SCOPe Domain Coordinates for d2qkba1:

Click to download the PDB-style file with coordinates for d2qkba1.
(The format of our PDB-style files is described here.)

Timeline for d2qkba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qkba2