![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225370] (7 PDB entries) |
![]() | Domain d2qkba1: 2qkb A:136-284 [205833] Other proteins in same PDB: d2qkba2, d2qkbb2 automated match to d2zqba_ protein/DNA complex; protein/RNA complex; complexed with edo, so4; mutant |
PDB Entry: 2qkb (more details), 2.4 Å
SCOPe Domain Sequences for d2qkba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qkba1 c.55.3.0 (A:136-284) automated matches {Human (Homo sapiens) [TaxId: 9606]} mgdfvvvytdgccssngrrrpragigvywgpghplnvgirlpgrqtnqraeihaackaie qaktqninklvlytnsmftingitnwvqgwkkngwktsagkevinkedfvalerltqgmd iqwmhvpghsgfigneeadrlaregakqs
Timeline for d2qkba1: