SCOPe 2.08: Domain d2qk9a1: 2qk9 A:136-286

Lineage for d2qk9a1 (2qk9 A:136-286)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225370] (7 PDB entries)

8. Domain d2qk9a1: 2qk9 A:136-286 [205832]
   Other proteins in same PDB: d2qk9a2
   automated match to d2zqba_
   protein/DNA complex; protein/RNA complex; complexed with 16d, flc, gol, na, so4; mutant

Details for d2qk9a1

PDB Entry: 2qk9, 2.55 Å

PDB Description: human rnase h catalytic domain mutant d210n in complex with 18-mer rna/dna hybrid

PDB Compounds: (A:) Ribonuclease H1

SCOPe Domain Sequences for d2qk9a1:

Sequence; same for both SEQRES and ATOM records:

>d2qk9a1 c.55.3.0 (A:136-286) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgdfvvvytdgccssngrrrpragigvywgpghplnvgirlpgrqtnqraeihaackaie
qaktqninklvlytnsmftingitnwvqgwkkngwktsagkevinkedfvalerltqgmd
iqwmhvpghsgfigneeadrlaregakqsed

Timeline for d2qk9a1:

• d2qk9a1 first appeared in SCOPe 2.03, called d2qk9a_
  
• d2qk9a1 appears in SCOPe 2.07