Lineage for d2qk9a1 (2qk9 A:136-286)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887306Species Human (Homo sapiens) [TaxId:9606] [225370] (7 PDB entries)
  8. 2887312Domain d2qk9a1: 2qk9 A:136-286 [205832]
    Other proteins in same PDB: d2qk9a2
    automated match to d2zqba_
    protein/DNA complex; protein/RNA complex; complexed with 16d, flc, gol, na, so4; mutant

Details for d2qk9a1

PDB Entry: 2qk9 (more details), 2.55 Å

PDB Description: human rnase h catalytic domain mutant d210n in complex with 18-mer rna/dna hybrid
PDB Compounds: (A:) Ribonuclease H1

SCOPe Domain Sequences for d2qk9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qk9a1 c.55.3.0 (A:136-286) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgdfvvvytdgccssngrrrpragigvywgpghplnvgirlpgrqtnqraeihaackaie
qaktqninklvlytnsmftingitnwvqgwkkngwktsagkevinkedfvalerltqgmd
iqwmhvpghsgfigneeadrlaregakqsed

SCOPe Domain Coordinates for d2qk9a1:

Click to download the PDB-style file with coordinates for d2qk9a1.
(The format of our PDB-style files is described here.)

Timeline for d2qk9a1: