Lineage for d2qjfb2 (2qjf B:393-622)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860964Species Human (Homo sapiens) [TaxId:9606] [188230] (4 PDB entries)
  8. 2860966Domain d2qjfb2: 2qjf B:393-622 [205830]
    Other proteins in same PDB: d2qjfa1, d2qjfb1
    automated match to d1jhda2
    complexed with adx, k

Details for d2qjfb2

PDB Entry: 2qjf (more details), 2.2 Å

PDB Description: Crystal structure of ATP-sulfurylase domain of human PAPS synthetase 1
PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d2qjfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjfb2 c.26.1.0 (B:393-622) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldqyrltptelkqkfkdmnadavfafqlrnpvhnghallmqdthkqllergyrrpvlllh
plggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcrarmv
aganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkkkrm
dyydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyyksle

SCOPe Domain Coordinates for d2qjfb2:

Click to download the PDB-style file with coordinates for d2qjfb2.
(The format of our PDB-style files is described here.)

Timeline for d2qjfb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qjfb1