| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
| Protein automated matches [190459] (61 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188230] (4 PDB entries) |
| Domain d2qjfb2: 2qjf B:393-622 [205830] Other proteins in same PDB: d2qjfa1, d2qjfb1 automated match to d1jhda2 complexed with adx, k |
PDB Entry: 2qjf (more details), 2.2 Å
SCOPe Domain Sequences for d2qjfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qjfb2 c.26.1.0 (B:393-622) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldqyrltptelkqkfkdmnadavfafqlrnpvhnghallmqdthkqllergyrrpvlllh
plggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcrarmv
aganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkkkrm
dyydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyyksle
Timeline for d2qjfb2: