| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries) |
| Domain d2qjdb_: 2qjd B: [205826] automated match to d1f6ll_ mutant |
PDB Entry: 2qjd (more details), 2.44 Å
SCOPe Domain Sequences for d2qjdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qjdb_ b.1.1.0 (B:) automated matches {Ictalurus punctatus [TaxId: 7998]}
ikelhvktvkrgenvtmecsmskvkdknklawyrqsfgkvpqyfvryyssnsgykfaegf
kdsrfsmtvndqkfdlniigtreddggeyfcgevegntikftsgtrlqf
Timeline for d2qjdb_: