SCOPe 2.08: Domain d2qjda_: 2qjd A:

Lineage for d2qjda_ (2qjd A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)

8. Domain d2qjda_: 2qjd A: [205825]
   automated match to d1f6ll_
   mutant

Details for d2qjda_

PDB Entry: 2qjd, 2.44 Å

PDB Description: crystal structure of novel immune-type receptor 10 extracellular fragment mutant n30d

PDB Compounds: (A:) Novel immune-type receptor 10

SCOPe Domain Sequences for d2qjda_:

Sequence; same for both SEQRES and ATOM records:

>d2qjda_ b.1.1.0 (A:) automated matches {Ictalurus punctatus [TaxId: 7998]}
ikelhvktvkrgenvtmecsmskvkdknklawyrqsfgkvpqyfvryyssnsgykfaegf
kdsrfsmtvndqkfdlniigtreddggeyfcgevegntikftsgtrlqf

Timeline for d2qjda_:

• d2qjda_ first appeared in SCOPe 2.03
  
• d2qjda_ appears in SCOPe 2.07