Lineage for d2qj4b2 (2qj4 B:128-210)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638015Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2638139Protein automated matches [226950] (2 species)
    not a true protein
  7. 2638160Species Mouse (Mus musculus) [TaxId:10090] [225317] (2 PDB entries)
  8. 2638162Domain d2qj4b2: 2qj4 B:128-210 [205824]
    Other proteins in same PDB: d2qj4a1, d2qj4b1
    automated match to d1bhta2
    complexed with so4

Details for d2qj4b2

PDB Entry: 2qj4 (more details), 2.5 Å

PDB Description: A Mechanistic Basis for Converting a Receptor Tyrosine Kinase Agonist to an Antagonist
PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d2qj4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qj4b2 g.14.1.1 (B:128-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nciigkggsykgtvsitksgikcqpwnsmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcsev

SCOPe Domain Coordinates for d2qj4b2:

Click to download the PDB-style file with coordinates for d2qj4b2.
(The format of our PDB-style files is described here.)

Timeline for d2qj4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qj4b1