SCOPe 2.03: Domain d2qj4b1: 2qj4 B:39-127

Lineage for d2qj4b1 (2qj4 B:39-127)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein automated matches [191160] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189357] (2 PDB entries)

8. Domain d2qj4b1: 2qj4 B:39-127 [205823]
   Other proteins in same PDB: d2qj4a2, d2qj4b2
   automated match to d1bhta1
   complexed with so4

Details for d2qj4b1

PDB Entry: 2qj4, 2.5 Å

PDB Description: A Mechanistic Basis for Converting a Receptor Tyrosine Kinase Agonist to an Antagonist

PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d2qj4b1:

Sequence; same for both SEQRES and ATOM records:

>d2qj4b1 g.10.1.1 (B:39-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkrcy
wypfnsmssgvkkgfghefdlyenkdyir

Timeline for d2qj4b1:

• d2qj4b1 is new in SCOPe 2.03-stable
  
• d2qj4b1 appears in SCOPe 2.04
  
• d2qj4b1 appears in the current release, SCOPe 2.08