Lineage for d2qj4a2 (2qj4 A:128-210)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461545Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1461546Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 1461547Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1461643Protein automated matches [226950] (2 species)
    not a true protein
  7. 1461650Species Mouse (Mus musculus) [TaxId:10090] [225317] (1 PDB entry)
  8. 1461651Domain d2qj4a2: 2qj4 A:128-210 [205822]
    Other proteins in same PDB: d2qj4a1, d2qj4b1
    automated match to d1bhta2
    complexed with so4

Details for d2qj4a2

PDB Entry: 2qj4 (more details), 2.5 Å

PDB Description: A Mechanistic Basis for Converting a Receptor Tyrosine Kinase Agonist to an Antagonist
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d2qj4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qj4a2 g.14.1.1 (A:128-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nciigkggsykgtvsitksgikcqpwnsmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcsev

SCOPe Domain Coordinates for d2qj4a2:

Click to download the PDB-style file with coordinates for d2qj4a2.
(The format of our PDB-style files is described here.)

Timeline for d2qj4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qj4a1