Lineage for d2qj4a1 (2qj4 A:39-127)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702965Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 1702966Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. 1702967Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
    automatically mapped to Pfam PF00024
  6. 1702997Protein automated matches [191160] (2 species)
    not a true protein
  7. 1703003Species Mouse (Mus musculus) [TaxId:10090] [189357] (3 PDB entries)
  8. 1703005Domain d2qj4a1: 2qj4 A:39-127 [205821]
    Other proteins in same PDB: d2qj4a2, d2qj4b2
    automated match to d1bhta1
    complexed with so4

Details for d2qj4a1

PDB Entry: 2qj4 (more details), 2.5 Å

PDB Description: A Mechanistic Basis for Converting a Receptor Tyrosine Kinase Agonist to an Antagonist
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d2qj4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qj4a1 g.10.1.1 (A:39-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkrcy
wypfnsmssgvkkgfghefdlyenkdyir

SCOPe Domain Coordinates for d2qj4a1:

Click to download the PDB-style file with coordinates for d2qj4a1.
(The format of our PDB-style files is described here.)

Timeline for d2qj4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qj4a2