![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
![]() | Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) ![]() the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
![]() | Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins) automatically mapped to Pfam PF00024 |
![]() | Protein automated matches [191160] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [189357] (2 PDB entries) |
![]() | Domain d2qj4a1: 2qj4 A:39-127 [205821] Other proteins in same PDB: d2qj4a2, d2qj4b2 automated match to d1bhta1 complexed with so4 |
PDB Entry: 2qj4 (more details), 2.5 Å
SCOPe Domain Sequences for d2qj4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qj4a1 g.10.1.1 (A:39-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkrcy wypfnsmssgvkkgfghefdlyenkdyir
Timeline for d2qj4a1: