Lineage for d2qhpa_ (2qhp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137718Species Bacteroides thetaiotaomicron [TaxId:226186] [225292] (1 PDB entry)
  8. 2137719Domain d2qhpa_: 2qhp A: [205817]
    automated match to d1tyya_
    complexed with edo

Details for d2qhpa_

PDB Entry: 2qhp (more details), 1.8 Å

PDB Description: crystal structure of fructokinase (np_810670.1) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution
PDB Compounds: (A:) fructokinase

SCOPe Domain Sequences for d2qhpa_:

Sequence, based on SEQRES records: (download)

>d2qhpa_ c.72.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
nniivgmgealwdvlpegkkiggapanfayhvsqfgfdsrvvsavgndelgdeimevfke
kqlknqiervdyptgtvqvtlddegvpcyeikegvawdnipftdelkrlalntravcfgs
laqrnevsratinrfldtmpdidgqlkifdinlrqdfytkevlresfkrcnilkindeel
vtisrmfgypgidlqdkcwillakynlkmliltcgingsyvftpgvvsfqetpkvpvadt
vgagdsftaafcasilngksvpeahklavevsayvctqsgampelpvilkdrll

Sequence, based on observed residues (ATOM records): (download)

>d2qhpa_ c.72.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
nniivgmgealwdvlpegkkiggapanfayhvsqfgfdsrvvsavgndelgdeimevfke
kqlknqiervdyptgtvqvtpcyeikegvawdnipftdelkrlalntravcfgslaqrne
vsratinrfldtmpdidgqlkifdinlrqdfytkevlresfkrcnilkindeelvtisrm
fgypgidlqdkcwillakynlkmliltcgingsyvftpgvvsfqetpkvpvadtvgagds
ftaafcasilngksvpeahklavevsayvctqsgampelpvilkdrll

SCOPe Domain Coordinates for d2qhpa_:

Click to download the PDB-style file with coordinates for d2qhpa_.
(The format of our PDB-style files is described here.)

Timeline for d2qhpa_: