SCOPe 2.06: Domain d2qhld_: 2qhl D:

Lineage for d2qhld_ (2qhl D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)

8. Domain d2qhld_: 2qhl D: [205815]
   Other proteins in same PDB: d2qhlc2
   automated match to d1cd0b_

Details for d2qhld_

PDB Entry: 2qhl, 1.56 Å

PDB Description: crystal structure of novel immune-type receptor 10 extracellular fragment from ictalurus punctatus

PDB Compounds: (D:) Novel immune-type receptor 10

SCOPe Domain Sequences for d2qhld_:

Sequence; same for both SEQRES and ATOM records:

>d2qhld_ b.1.1.0 (D:) automated matches {Ictalurus punctatus [TaxId: 7998]}
ikelhvktvkrgenvtmecsmskvkdkdklawyrqsfgkvpqyfvryyssnsgykfaegf
kdsrfsmtvndqkfdlniigtreddggeyfcgevegntikftsgtrlqf

Timeline for d2qhld_:

• d2qhld_ first appeared in SCOPe 2.03
  
• d2qhld_ appears in SCOPe 2.05
  
• d2qhld_ appears in SCOPe 2.07
  
• d2qhld_ appears in the current release, SCOPe 2.08