Lineage for d2qhlb_ (2qhl B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759376Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)
  8. 2759378Domain d2qhlb_: 2qhl B: [205813]
    Other proteins in same PDB: d2qhlc2
    automated match to d1cd0b_

Details for d2qhlb_

PDB Entry: 2qhl (more details), 1.56 Å

PDB Description: crystal structure of novel immune-type receptor 10 extracellular fragment from ictalurus punctatus
PDB Compounds: (B:) Novel immune-type receptor 10

SCOPe Domain Sequences for d2qhlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qhlb_ b.1.1.0 (B:) automated matches {Ictalurus punctatus [TaxId: 7998]}
dikelhvktvkrgenvtmecsmskvkdkdklawyrqsfgkvpqyfvryyssnsgykfaeg
fkdsrfsmtvndqkfdlniigtreddggeyfcgevegntikftsgtrlqf

SCOPe Domain Coordinates for d2qhlb_:

Click to download the PDB-style file with coordinates for d2qhlb_.
(The format of our PDB-style files is described here.)

Timeline for d2qhlb_: