Lineage for d2qg5b1 (2qg5 B:12-287)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2222217Species Cryptosporidium parvum [TaxId:353152] [196400] (5 PDB entries)
  8. 2222221Domain d2qg5b1: 2qg5 B:12-287 [205808]
    Other proteins in same PDB: d2qg5a2, d2qg5b2, d2qg5d2
    automated match to d4eomc_

Details for d2qg5b1

PDB Entry: 2qg5 (more details), 2.3 Å

PDB Description: Cryptosporidium parvum calcium dependent protein kinase cgd7_1840
PDB Compounds: (B:) calcium/calmodulin-dependent protein kinase

SCOPe Domain Sequences for d2qg5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qg5b1 d.144.1.0 (B:12-287) automated matches {Cryptosporidium parvum [TaxId: 353152]}
enlyfqgstkgdinqyytlentigrgswgevkiavqkgtrirraakkipkyfvedvdrfk
qeieimksldhpniirlyetfedntdiylvmelctggelfervvhkrvfresdaarimkd
vlsavaychklnvahrdlkpenflfltdspdsplklidfglaarfkpgkmmrtkvgtpyy
vspqvleglygpecdewsagvmmyvllcgyppfsaptdsevmlkiregtftfpekdwlnv
spqaeslirrlltkspkqritslqalehewfekqls

SCOPe Domain Coordinates for d2qg5b1:

Click to download the PDB-style file with coordinates for d2qg5b1.
(The format of our PDB-style files is described here.)

Timeline for d2qg5b1: