Lineage for d2qg5a1 (2qg5 A:19-287)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984883Species Cryptosporidium parvum [TaxId:353152] [196400] (5 PDB entries)
  8. 2984886Domain d2qg5a1: 2qg5 A:19-287 [205807]
    Other proteins in same PDB: d2qg5a2, d2qg5b2, d2qg5d2
    automated match to d4eomc_

Details for d2qg5a1

PDB Entry: 2qg5 (more details), 2.3 Å

PDB Description: Cryptosporidium parvum calcium dependent protein kinase cgd7_1840
PDB Compounds: (A:) calcium/calmodulin-dependent protein kinase

SCOPe Domain Sequences for d2qg5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qg5a1 d.144.1.0 (A:19-287) automated matches {Cryptosporidium parvum [TaxId: 353152]}
stkgdinqyytlentigrgswgevkiavqkgtrirraakkipkyfvedvdrfkqeieimk
sldhpniirlyetfedntdiylvmelctggelfervvhkrvfresdaarimkdvlsavay
chklnvahrdlkpenflfltdspdsplklidfglaarfkpgkmmrtkvgtpyyvspqvle
glygpecdewsagvmmyvllcgyppfsaptdsevmlkiregtftfpekdwlnvspqaesl
irrlltkspkqritslqalehewfekqls

SCOPe Domain Coordinates for d2qg5a1:

Click to download the PDB-style file with coordinates for d2qg5a1.
(The format of our PDB-style files is described here.)

Timeline for d2qg5a1: