![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
![]() | Protein automated matches [190072] (22 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225478] (4 PDB entries) |
![]() | Domain d2qfyf_: 2qfy F: [205806] automated match to d4hcxb_ complexed with akg |
PDB Entry: 2qfy (more details), 2.1 Å
SCOPe Domain Sequences for d2qfyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qfyf_ c.77.1.1 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fskikvkqpvveldgdemtriiwdkikkklilpyldvdlkyydlsvesrdatsdkitqda aeaikkygvgikcatitpdearvkefnlhkmwkspngtirnilggtvfrepivipriprl vprwekpiiigrhahgdqykatdtlipgpgslelvykpsdpttaqpqtlkvydykgsgva mamyntdesiegfahssfklaidkklnlflstkntilkkydgrfkdifqevyeaqykskf eqlgihyehrliddmvaqmikskggfimalknydgdvqsdivaqgfgslglmtsilvtpd gktfeseaahgtvtrhyrkyqkgeetstnsiasifawsrgllkrgeldntpalckfanil esatlntvqqdgimtkdlalacgnnersayvtteefldavekrlqkeiksi
Timeline for d2qfyf_: