Lineage for d2qfxf_ (2qfx F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513204Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2513401Protein automated matches [190072] (22 species)
    not a true protein
  7. 2513421Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225478] (4 PDB entries)
  8. 2513443Domain d2qfxf_: 2qfx F: [205800]
    automated match to d4hcxb_
    complexed with akg, ca, ndp

Details for d2qfxf_

PDB Entry: 2qfx (more details), 2.7 Å

PDB Description: crystal structure of saccharomyces cerevesiae mitochondrial nadp(+)- dependent isocitrate dehydrogenase in complex with nadph, a- ketoglutarate and ca(2+)
PDB Compounds: (F:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d2qfxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfxf_ c.77.1.1 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fskikvkqpvveldgdemtriiwdkikkklilpyldvdlkyydlsvesrdatsdkitqda
aeaikkygvgikcatitpdearvkefnlhkmwkspngtirnilggtvfrepivipriprl
vprwekpiiigrhahgdqykatdtlipgpgslelvykpsdpttaqpqtlkvydykgsgva
mamyntdesiegfahssfklaidkklnlflstkntilkkydgrfkdifqevyeaqykskf
eqlgihyehrliddmvaqmikskggfimalknydgdvqsdivaqgfgslglmtsilvtpd
gktfeseaahgtvtrhyrkyqkgeetstnsiasifawsrgllkrgeldntpalckfanil
esatlntvqqdgimtkdlalacgnnersayvtteefldavekrlqkeiks

SCOPe Domain Coordinates for d2qfxf_:

Click to download the PDB-style file with coordinates for d2qfxf_.
(The format of our PDB-style files is described here.)

Timeline for d2qfxf_: