SCOPe 2.08: Domain d2qfvb_: 2qfv B:

Lineage for d2qfvb_ (2qfv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (22 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225478] (4 PDB entries)

8. Domain d2qfvb_: 2qfv B: [205786]
   automated match to d4hcxb_
   complexed with nap

Details for d2qfvb_

PDB Entry: 2qfv, 2.3 Å

PDB Description: crystal structure of saccharomyces cerevesiae mitochondrial nadp(+)- dependent isocitrate dehydrogenase in complex with nadp(+)

PDB Compounds: (B:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d2qfvb_:

Sequence; same for both SEQRES and ATOM records:

>d2qfvb_ c.77.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kikvkqpvveldgdemtriiwdkikkklilpyldvdlkyydlsvesrdatsdkitqdaae
aikkygvgikcatitpdearvkefnlhkmwkspngtirnilggtvfrepivipriprlvp
rwekpiiigrhahgdqykatdtlipgpgslelvykpsdpttaqpqtlkvydykgsgvama
myntdesiegfahssfklaidkklnlflstkntilkkydgrfkdifqevyeaqykskfeq
lgihyehrliddmvaqmikskggfimalknydgdvqsdivaqgfgslglmtsilvtpdgk
tfeseaahgtvtrhyrkyqkgeetstnsiasifawsrgllkrgeldntpalckfaniles
atlntvqqdgimtkdlalacgnnersayvtteefldavekrlqkeiks

Timeline for d2qfvb_:

• d2qfvb_ first appeared in SCOPe 2.03
  
• d2qfvb_ appears in SCOPe 2.07