Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) |
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (29 PDB entries) |
Domain d2qf2a1: 2qf2 A:10-259 [205781] Other proteins in same PDB: d2qf2a2, d2qf2b2 automated match to d1khba2 complexed with gdp, mn, na, oaa, pyr |
PDB Entry: 2qf2 (more details), 1.65 Å
SCOPe Domain Sequences for d2qf2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qf2a1 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]} dfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqeegvirkl kkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedfekafnar fpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvlealgdgef ikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgkkcfalr iasrlakeeg
Timeline for d2qf2a1: