Lineage for d2qf1a2 (2qf1 A:260-622)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143073Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 protein domains)
  6. 2143074Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69612] (2 species)
  7. 2143084Species Norway rat (Rattus norvegicus) [TaxId:10116] [225316] (40 PDB entries)
  8. 2143107Domain d2qf1a2: 2qf1 A:260-622 [205780]
    Other proteins in same PDB: d2qf1a1
    automated match to d1khba1
    complexed with mn, na, oaa

Details for d2qf1a2

PDB Entry: 2qf1 (more details), 1.8 Å

PDB Description: rat cytosolic pepck in complex with oxaloacetic acid.
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d2qf1a2:

Sequence, based on SEQRES records: (download)

>d2qf1a2 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wlaehmlilgitnpegkkkylaaafpsacgktnlammnptlpgwkvecvgddiawmkfda
qgnlrainpengffgvapgtsvktnpnaiktiqkntiftnvaetsdggvywegideplap
gvtitswknkewrpqdeepcahpnsrfctpasqcpiidpawespegvpiegiifggrrpa
gvplvyealswqhgvfvgaamrseataaaehkgkvimhdpfamrpffgynfgkylahwls
mahrpaaklpkifhvnwfrkdkngkflwpgfgensrvlewmfgriegedsakltpigyvp
kedalnlkglgdvnveelfgiskefwekeveeidkyledqvnadlpyeierelralkqri
sqm

Sequence, based on observed residues (ATOM records): (download)

>d2qf1a2 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wlaehmlilgitnpegkkkylaaafpsacgktnlammnptlpgwkvecvgddiawmkfda
qgnlrainpengffgvapgtsvktnpnaiktiqkntiftnvaetsdggvywegideplap
gvtitswknkewrpqdeepcahpnsrfctpasqcpiidpawespegvpiegiifggrrpa
gvplvyealswqhgvfvgaamrseagkvimhdpfamrpffgynfgkylahwlsmahrpaa
klpkifhvnwfrkdkngkflwpgfgensrvlewmfgriegedsakltpigyvpkedalnl
kglgdvnveelfgiskefwekeveeidkyledqvnadlpyeierelralkqrisqm

SCOPe Domain Coordinates for d2qf1a2:

Click to download the PDB-style file with coordinates for d2qf1a2.
(The format of our PDB-style files is described here.)

Timeline for d2qf1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qf1a1