![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
![]() | Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries) |
![]() | Domain d2qf1a1: 2qf1 A:10-259 [205779] Other proteins in same PDB: d2qf1a2 automated match to d1khba2 complexed with mn, na, oaa |
PDB Entry: 2qf1 (more details), 1.8 Å
SCOPe Domain Sequences for d2qf1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qf1a1 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]} dfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqeegvirkl kkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedfekafnar fpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvlealgdgef ikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgkkcfalr iasrlakeeg
Timeline for d2qf1a1: