| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
| Family a.204.1.0: automated matches [191410] (1 protein) not a true family |
| Protein automated matches [190562] (4 species) not a true protein |
| Species Vibrio sp. [TaxId:344879] [188224] (3 PDB entries) |
| Domain d2q9lc_: 2q9l C: [205767] automated match to d2q73d_ complexed with mg |
PDB Entry: 2q9l (more details), 2.2 Å
SCOPe Domain Sequences for d2q9lc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q9lc_ a.204.1.0 (C:) automated matches {Vibrio sp. [TaxId: 344879]}
efdyapeqsehyffklieevgelsesirkgksgqptldelkgsvaeelydvlyyvcalan
ihgvnlekthelkevlnkv
Timeline for d2q9lc_: