SCOPe 2.03: Domain d2q6ka1: 2q6k A:1-163

Lineage for d2q6ka1 (2q6k A:1-163)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold

4. Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families)

5. Family c.132.1.0: automated matches [227219] (1 protein)
   not a true family

6. Protein automated matches [226958] (1 species)
   not a true protein

7. Species Salinispora tropica [TaxId:369723] [225386] (2 PDB entries)

8. Domain d2q6ka1: 2q6k A:1-163 [205757]
   Other proteins in same PDB: d2q6ka2
   automated match to d1rqpa2
   complexed with adn, peg

Details for d2q6ka1

PDB Entry: 2q6k, 1.55 Å

PDB Description: SalL with adenosine

PDB Compounds: (A:) chlorinase

SCOPe Domain Sequences for d2q6ka1:

Sequence; same for both SEQRES and ATOM records:

>d2q6ka1 c.132.1.0 (A:1-163) automated matches {Salinispora tropica [TaxId: 369723]}
mqhnliaflsdvgsadeahalckgvmygvapaativdithdvapfdvregalfladvphs
fpahtvicayvypetgtathtiavrnekgqllvgpnngllsfaldaspavechevlspdv
mnqpvtptwygkdivaacaahlaagtdlaavgpridpkqivrl

Timeline for d2q6ka1:

• d2q6ka1 is new in SCOPe 2.03-stable
  
• d2q6ka1 appears in SCOPe 2.04
  
• d2q6ka1 appears in the current release, SCOPe 2.08