Lineage for d2q60c_ (2q60 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2730185Species Tunicate (Polyandrocarpa misakiensis) [TaxId:7723] [225459] (1 PDB entry)
  8. 2730188Domain d2q60c_: 2q60 C: [205755]
    automated match to d2xhsa_

Details for d2q60c_

PDB Entry: 2q60 (more details), 2.9 Å

PDB Description: crystal structure of the ligand binding domain of polyandrocarpa misakiensis rxr in tetramer in absence of ligand
PDB Compounds: (C:) retinoid x receptor

SCOPe Domain Sequences for d2q60c_:

Sequence, based on SEQRES records: (download)

>d2q60c_ a.123.1.0 (C:) automated matches {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]}
nddmpvdkileaelisdpkveqvvpfeqvnendpvsnickaadrqlvtlvewakriphfs
slpledqvillragwnelliasfshrsidvkdsillasglhvhrhsahqagvgpifdrvl
telvskmrdmmmdktelgclravvlfnpdvknpsdsahieslrekvyasleaycrskypd
qpgrfaklllrlpalrsiglkclehlfffkligdtpidkfl

Sequence, based on observed residues (ATOM records): (download)

>d2q60c_ a.123.1.0 (C:) automated matches {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]}
nddmpvdkileaelisdpnickaadrqlvtlvewakriphfsslpledqvillragwnel
liasfshrsidvkdsillasglhvhrhsahqagvgpifdrvltelvskmrdmmmdktelg
clravvlfnpdvknpsdsahieslrekvyasleaycrskypdqpgrfaklllrlpalrsi
glkclehlfffkligdtpidkfl

SCOPe Domain Coordinates for d2q60c_:

Click to download the PDB-style file with coordinates for d2q60c_.
(The format of our PDB-style files is described here.)

Timeline for d2q60c_: