Lineage for d2q60b_ (2q60 B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502431Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1502432Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1503538Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 1503539Protein automated matches [191142] (5 species)
    not a true protein
  7. 1503561Species Tunicate (Polyandrocarpa misakiensis) [TaxId:7723] [225459] (1 PDB entry)
  8. 1503563Domain d2q60b_: 2q60 B: [205754]
    automated match to d2xhsa_

Details for d2q60b_

PDB Entry: 2q60 (more details), 2.9 Å

PDB Description: crystal structure of the ligand binding domain of polyandrocarpa misakiensis rxr in tetramer in absence of ligand
PDB Compounds: (B:) retinoid x receptor

SCOPe Domain Sequences for d2q60b_:

Sequence, based on SEQRES records: (download)

>d2q60b_ a.123.1.0 (B:) automated matches {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]}
ddmpvdkileaelisdpkveqvvpfeqvnendpvsnickaadrqlvtlvewakriphfss
lpledqvillragwnelliasfshrsidvkdsillasglhvhrhsahqagvgpifdrvlt
elvskmrdmmmdktelgclravvlfnpdvknpsdsahieslrekvyasleaycrskypdq
pgrfaklllrlpalrsiglkclehlfffkligdtpidkf

Sequence, based on observed residues (ATOM records): (download)

>d2q60b_ a.123.1.0 (B:) automated matches {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]}
ddmpvdkileaelisdckaadrqlvtlvewakriphfsslpledqvillragwnellias
fshrsidvkdsillasglhvhrhsahqagvgpifdrvltelvskmrdmmmdktelgclra
vvlfnpdvknpsdsahieslrekvyasleaycrskypdqpgrfaklllrlpalrsiglkc
lehlfffkligdtpidkf

SCOPe Domain Coordinates for d2q60b_:

Click to download the PDB-style file with coordinates for d2q60b_.
(The format of our PDB-style files is described here.)

Timeline for d2q60b_: