Lineage for d2q5rc_ (2q5r C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1385058Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1385059Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1385284Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1385285Protein automated matches [190117] (34 species)
    not a true protein
  7. 1385448Species Staphylococcus aureus [TaxId:1280] [187913] (3 PDB entries)
  8. 1385457Domain d2q5rc_: 2q5r C: [205751]
    automated match to d2awdb_

Details for d2q5rc_

PDB Entry: 2q5r (more details), 2.3 Å

PDB Description: structure of apo staphylococcus aureus d-tagatose-6-phosphate kinase
PDB Compounds: (C:) tagatose-6-phosphate kinase

SCOPe Domain Sequences for d2q5rc_:

Sequence, based on SEQRES records: (download)

>d2q5rc_ c.72.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
hmiltltlnpsvdisypltalklddvnrvqevsktaggkglnvtrvlaqvgepvlasgfi
ggelgqfiakkldhadikhafynikgetrnciailhegqqteileqgpeidnqeaagfik
hfeqllekveavaisgslpkglnqdyyaqiiercqnkgvpvildcsgatlqtvlenpykp
tvikpniselyqllnqpldesleslkqavsqplfegiewiivslgaqgafakhnhtfyrv
niptisvlnpvgsgdstvagitsailnhendhdllkkantlgmlnaqeaqtgyvnlnnyd
dlfnqievlev

Sequence, based on observed residues (ATOM records): (download)

>d2q5rc_ c.72.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
hmiltltlnpsvdisypltalklddvnrvqevsktaggkglnvtrvlaqvgepvlasgfi
ggelgqfiakkldhadikhafynikgetrnciailhegqqteileqgpeidnqeaagfik
hfeqllekveavaisgslpkglnqdyyaqiiercqnkgvpvildcsgatlqtvlenpykp
tvikpniselyqllnqpldesleslkqavsqplfegiewiivslgaqgafakhnhtfyrv
niptipvgsgdstvagitsailnhendhdllkkantlgmlnatgyvnlnnyddlfnqiev
lev

SCOPe Domain Coordinates for d2q5rc_:

Click to download the PDB-style file with coordinates for d2q5rc_.
(The format of our PDB-style files is described here.)

Timeline for d2q5rc_: