SCOPe 2.08: Domain d2q5ra1: 2q5r A:1-310

Lineage for d2q5ra1 (2q5r A:1-310)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [187913] (4 PDB entries)

8. Domain d2q5ra1: 2q5r A:1-310 [205749]
   Other proteins in same PDB: d2q5ra2, d2q5rb2, d2q5rc2, d2q5rd2
   automated match to d2awdb_

Details for d2q5ra1

PDB Entry: 2q5r, 2.3 Å

PDB Description: structure of apo staphylococcus aureus d-tagatose-6-phosphate kinase

PDB Compounds: (A:) tagatose-6-phosphate kinase

SCOPe Domain Sequences for d2q5ra1:

Sequence; same for both SEQRES and ATOM records:

>d2q5ra1 c.72.1.0 (A:1-310) automated matches {Staphylococcus aureus [TaxId: 1280]}
miltltlnpsvdisypltalklddvnrvqevsktaggkglnvtrvlaqvgepvlasgfig
gelgqfiakkldhadikhafynikgetrnciailhegqqteileqgpeidnqeaagfikh
feqllekveavaisgslpkglnqdyyaqiiercqnkgvpvildcsgatlqtvlenpykpt
vikpniselyqllnqpldesleslkqavsqplfegiewiivslgaqgafakhnhtfyrvn
iptisvlnpvgsgdstvagitsailnhendhdllkkantlgmlnaqeaqtgyvnlnnydd
lfnqievlev

Timeline for d2q5ra1:

• d2q5ra1 first appeared in SCOPe 2.03, called d2q5ra_
  
• d2q5ra1 appears in SCOPe 2.07