SCOPe 2.08: Domain d2q4wa1: 2q4w A:34-238

Lineage for d2q4wa1 (2q4w A:34-238)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.0: automated matches [191624] (1 protein)
   not a true family

6. Protein automated matches [191143] (13 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225037] (2 PDB entries)

8. Domain d2q4wa1: 2q4w A:34-238 [205747]
   Other proteins in same PDB: d2q4wa2
   automated match to d1w1oa2
   complexed with fad

Details for d2q4wa1

PDB Entry: 2q4w, 1.7 Å

PDB Description: Ensemble refinement of the protein crystal structure of cytokinin oxidase/dehydrogenase (CKX) from Arabidopsis thaliana At5g21482

PDB Compounds: (A:) Cytokinin dehydrogenase 7

SCOPe Domain Sequences for d2q4wa1:

Sequence; same for both SEQRES and ATOM records:

>d2q4wa1 d.145.1.0 (A:34-238) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lniqgeilcggaaadiagrdfggmncvkplavvrpvgpediagavkaalrsdkltvaarg
nghsingqamaegglvvdmsttaenhfevgylsggdatafvdvsggalwedvlkrcvsey
glaprswtdylgltvggtlsnagvsgqafrygpqtsnvteldvvtgngdvvtcseiense
lffsvlgglgqfgiitrarvllqpa

Timeline for d2q4wa1:

• d2q4wa1 first appeared in SCOPe 2.03
  
• d2q4wa1 appears in SCOPe 2.07