| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
| Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
| Protein automated matches [191143] (13 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225037] (2 PDB entries) |
| Domain d2q4wa1: 2q4w A:34-238 [205747] Other proteins in same PDB: d2q4wa2 automated match to d1w1oa2 complexed with fad |
PDB Entry: 2q4w (more details), 1.7 Å
SCOPe Domain Sequences for d2q4wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q4wa1 d.145.1.0 (A:34-238) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lniqgeilcggaaadiagrdfggmncvkplavvrpvgpediagavkaalrsdkltvaarg
nghsingqamaegglvvdmsttaenhfevgylsggdatafvdvsggalwedvlkrcvsey
glaprswtdylgltvggtlsnagvsgqafrygpqtsnvteldvvtgngdvvtcseiense
lffsvlgglgqfgiitrarvllqpa
Timeline for d2q4wa1: