Lineage for d2q4eb1 (2q4e B:6-133,B:305-360)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2844118Protein Probable oxidoreductase At4g09670 [117429] (1 species)
  7. 2844119Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117430] (2 PDB entries)
    Uniprot Q9SZ83
  8. 2844121Domain d2q4eb1: 2q4e B:6-133,B:305-360 [205745]
    Other proteins in same PDB: d2q4ea2, d2q4eb2
    automated match to d1ydwa1

Details for d2q4eb1

PDB Entry: 2q4e (more details), 2.49 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At4g09670
PDB Compounds: (B:) Probable oxidoreductase At4g09670

SCOPe Domain Sequences for d2q4eb1:

Sequence, based on SEQRES records: (download)

>d2q4eb1 c.2.1.3 (B:6-133,B:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
mdgtmwvhXpqeacmvrefarlvgeiknngakpdgywpsisrktqlvvdavkesvdknyq
qisls

Sequence, based on observed residues (ATOM records): (download)

>d2q4eb1 c.2.1.3 (B:6-133,B:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
mdgtmwvhXpqeacmvrefaiknngakpdgywpsisrktqlvvdavkesvdknyqqisls

SCOPe Domain Coordinates for d2q4eb1:

Click to download the PDB-style file with coordinates for d2q4eb1.
(The format of our PDB-style files is described here.)

Timeline for d2q4eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q4eb2