Lineage for d2q4ea2 (2q4e A:134-304)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568239Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2568240Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2568765Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 2568838Protein Probable oxidoreductase At4g09670 [118039] (1 species)
  7. 2568839Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118040] (2 PDB entries)
    Uniprot Q9SZ83
  8. 2568840Domain d2q4ea2: 2q4e A:134-304 [205744]
    Other proteins in same PDB: d2q4ea1, d2q4eb1
    automated match to d1ydwa2

Details for d2q4ea2

PDB Entry: 2q4e (more details), 2.49 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At4g09670
PDB Compounds: (A:) Probable oxidoreductase At4g09670

SCOPe Domain Sequences for d2q4ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4ea2 d.81.1.5 (A:134-304) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgldglgalgdagwyai
ratllannfelpktvtafpgavlneagvilscgaslswedgrtatiycsflanltmeita
igtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtvktel

SCOPe Domain Coordinates for d2q4ea2:

Click to download the PDB-style file with coordinates for d2q4ea2.
(The format of our PDB-style files is described here.)

Timeline for d2q4ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q4ea1