SCOPe 2.03: Domain d2q4ea2: 2q4e A:134-304

Lineage for d2q4ea2 (2q4e A:134-304)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
   has many additional secondary structures

6. Protein Probable oxidoreductase At4g09670 [118039] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118040] (2 PDB entries)
   Uniprot Q9SZ83

8. Domain d2q4ea2: 2q4e A:134-304 [205744]
   Other proteins in same PDB: d2q4ea1, d2q4eb1
   automated match to d1ydwa2

Details for d2q4ea2

PDB Entry: 2q4e, 2.49 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At4g09670

PDB Compounds: (A:) Probable oxidoreductase At4g09670

SCOPe Domain Sequences for d2q4ea2:

Sequence; same for both SEQRES and ATOM records:

>d2q4ea2 d.81.1.5 (A:134-304) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgldglgalgdagwyai
ratllannfelpktvtafpgavlneagvilscgaslswedgrtatiycsflanltmeita
igtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtvktel

Timeline for d2q4ea2:

• d2q4ea2 is new in SCOPe 2.03-stable
  
• d2q4ea2 appears in SCOPe 2.04
  
• d2q4ea2 appears in the current release, SCOPe 2.08